bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1883_orf2 Length=199 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3720 127 3e-28 > 5807.cgd8_3720 Length=475 Score = 127 bits (318), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 68/176 (38%), Positives = 101/176 (57%), Gaps = 17/176 (9%) Query 1 DMGHHIKNCPKSADAKQQKKIRPATGLPSSFLKDILPSEIHR-HQEVYIKKDGSFAVLKT 59 + GHHI+ CPK + QKKIRPATG+P SFL+ I E R + EVY DG+FAVLK Sbjct 299 ERGHHIRVCPKVNEGVSQKKIRPATGIPRSFLRAINFDEEGRLYSEVYCLPDGTFAVLKD 358 Query 60 GA-LGSLSLLGSSLDLRIQRHVGGAAH--------LKCCCCSSIFKSPTLTPCCGETFCR 110 L S + L +++ I +H+G + L C C+ +F+ LTPCCGET+C+ Sbjct 359 AKQLSSTAFLTRTVEDTIGKHMGKSKEDTSLVRDSLTCPICARLFRYAVLTPCCGETYCQ 418 Query 111 ACIVLYLQQHPAAAADPGSSSAAAAAAGLVGHCPGCNAAIAAADLAANTVLQQSVD 166 CI+ +++ H AA + + + G+CP C+ I+ ADL N +++SV+ Sbjct 419 ECIINFIRNHMDAA-------SGISPNTIKGYCPHCSTVISIADLEPNNPIRKSVN 467 Lambda K H 0.319 0.128 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47162034073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40