bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1935_orf3 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5141.NCU09995.1 89.7 2e-17 > 5141.NCU09995.1 Length=103 Score = 89.7 bits (221), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 49/93 (52%), Positives = 64/93 (68%), Gaps = 3/93 (3%) Query 33 PKKAAKAAKPTK--RTRAKKDPDAPKRGTPAYIFFMKDKREEICKKNPNVKSATQIAALV 90 PK AAK+ K + RAKKDP+APKRG AY+FF ++RE + ++NP V S Q+ ++ Sbjct 2 PKAAAKSKTTGKVEKRRAKKDPNAPKRGLSAYMFFANEQRENVREENPGV-SFGQVGKIL 60 Query 91 GEEWKKLSPSQKAPYEKKAEADKQRYQKEVAAY 123 GE WK LS Q+APYE KA ADK+RY+ E AY Sbjct 61 GERWKALSDKQRAPYEAKAAADKKRYEDEKQAY 93 Lambda K H 0.311 0.126 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40