bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1963_orf1 Length=336 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000008206 72.8 1e-11 > 7719.ENSCINP00000008206 Length=252 Score = 72.8 bits (177), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 43/109 (39%), Positives = 58/109 (53%), Gaps = 7/109 (6%) Query 61 VDIGIYYESRCPASQLFITEQLQDAAQHAKELQLAKVAIHPVPYGNTKETLTETGHYQYE 120 V+I +Y+ES CP + FIT QL KE + ++ VPYGN KE +G + Y Sbjct 55 VNIELYFESLCPGCRQFITTQLYPTWMSLKESGIMAASM--VPYGNAKEVQLSSGLWNYT 112 Query 121 CQHGPEECYLNRVEACGLALMKEAQIDVWAPWLDCVNKSQLDAASLIKA 169 CQHG EEC N +E C + E + D + P L C+ DA+ IKA Sbjct 113 CQHGAEECVGNLIENC-IIHYSEDKFDTYFPILYCME----DASDPIKA 156 Lambda K H 0.320 0.130 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 124299612944 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40