bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1994_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0620w 119 2e-26 > 5833.PFB0620w Length=154 Score = 119 bits (299), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 53/137 (38%), Positives = 88/137 (64%), Gaps = 0/137 (0%) Query 23 MASLEETAKVFQNKFETMIKEITILSLPMQKKSFQCCVSCFDSHKQDPEKIAECINQCHE 82 + +L + FQ+K + M+ I+ SLP QKKSF CCV+CFD++ D E I +C+N C + Sbjct 13 ITNLTKRTNEFQSKIDGMLNNISTESLPFQKKSFMCCVNCFDTYNTDFETIGKCVNNCQK 72 Query 83 PSQSFNRVLQREVEGLQTNIESCQKICFNRLAPKLEGASSQTEKTAIEREKDECFVQCFT 142 ++ F +V+Q E++ LQ N++SCQ+ CF + +P ++S + IE+E + C V+CF Sbjct 73 GTEHFVQVVQNEMQNLQNNLQSCQQSCFYKYSPNYAKSNSNIDGPTIEKEMETCVVKCFD 132 Query 143 SNIPIIAEIRDRLKRRI 159 + P++ EI DRL + + Sbjct 133 KHEPMLPEISDRLHKTL 149 Lambda K H 0.323 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40