bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2031_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0092 72.4 6e-12 > 5833.PF11_0092 Length=1812 Score = 72.4 bits (176), Expect = 6e-12, Method: Composition-based stats. Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 6/111 (5%) Query 1 STNATFSMPMRLDIRTQLQALRFLEAGMRRAIAARPMDFVKDSFSIYITDVQPGRWMDIT 60 S NA + ++DI T L AL+ L ++ + +RP DF K + +QPG + +I+ Sbjct 1275 SKNAYIDISFKVDINTPLVALKELRKSLQCLVDSRPSDFCKTKNLYFGYSLQPGHFYEIS 1334 Query 61 VWLSAVEGWGNAPKVLRLRTDM--FLVLQ-RLCTRFGISYQEPLLPVHLNA 108 W+ VEGWGN KV LRTD+ F++LQ R+ ISY+ P + A Sbjct 1335 FWIKCVEGWGNWRKVFELRTDIYDFIILQLRI---LSISYRLPTQKIGFTA 1382 Lambda K H 0.321 0.134 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40