bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2044_orf1 Length=132 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G29120.1 114 1e-24 > 3702.AT4G29120.1 Length=334 Score = 114 bits (284), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 55/118 (46%), Positives = 80/118 (67%), Gaps = 1/118 (0%) Query 10 AATMTCTEAVPGKTRIGWIGTGVMGRSMCENLLKKGFLLTVYNRTASKAAPLQQQGAELA 69 ++T++ P T+IGWIGTGVMGRSMC +L+K G+ +TV+NRT SKA L GA +A Sbjct 25 SSTISSDIITPSNTKIGWIGTGVMGRSMCGHLIKAGYTVTVFNRTISKAQTLIDMGANVA 84 Query 70 ESAGAVAAKSDVLCLMVGTPEDVQQLIFG-KEGLAEKLVKGSCLIDFTTSSPALADQV 126 +S +VA +SDV+ +VG P DV+ ++ K G L +G L+D TTS P+LA+++ Sbjct 85 DSPNSVAEQSDVVFTIVGYPSDVRHVLLDPKSGALSGLRQGGVLVDMTTSEPSLAEEI 142 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40