bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2072_orf2 Length=234 Score E Sequences producing significant alignments: (Bits) Value 6239.Y47H9C.5a.2 79.7 6e-14 > 6239.Y47H9C.5a.2 Length=788 Score = 79.7 bits (195), Expect = 6e-14, Method: Composition-based stats. Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 16/187 (8%) Query 55 AASFYQLLKLSKGATETEVKRAYRRLSLELHPDRVKLKNGDLKKAEETFQQINKAYQVLS 114 A +Y+LL + + A + +++A+++L+++ HPDR N D A + F +INKAY+VL Sbjct 18 AEDYYELLGVERDADDRTIRKAFKKLAIKKHPDR----NTDDPNAHDEFVKINKAYEVLK 73 Query 115 NRRSRRLFDVYGQLWESQEVYYLDLESSKSKEIYNFKNGVF-------LLSLSNLNLLLR 167 + R+ +D +G+ + E + + +S + YN G++ L+ ++ ++ Sbjct 74 DENLRKKYDQFGE--KGLEDGFQGGNNYQSWQFYNDNFGIYDDDQEIVTLNRADFQRMVS 131 Query 168 SSPYTWIVGFYQAGCASCEQKVPFFSALGEQTLKTAGVRLAMANCVASP-ICNYFGVREL 226 S W + FY C+ C Q P + + T +R+ NC P +C V Sbjct 132 DSNEIWFINFYSTYCSHCHQLAPTWRKFAREIEGT--IRVGAVNCAEDPQLCQSQRVNAY 189 Query 227 NQIYLFP 233 + +P Sbjct 190 PSLVFYP 196 Lambda K H 0.320 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 66828013670 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40