bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2189_orf2 Length=145 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0195c 80.9 9e-15 > 5833.PFI0195c Length=426 Score = 80.9 bits (198), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 4/106 (3%) Query 41 MIGSSEFWETEREAPLLNRNANFFCPESAAALQQRAAKLL-LLLEERHGAAAVEPQLLQP 99 MI ++FW+ E++AP+L RNAN+ E+ + +RA ++L VE ++ Sbjct 1 MIVGNKFWDEEKDAPILKRNANYINRENCEYICKRAEHFYEIMLSYIKEDIDVE---IKE 57 Query 100 DCEDEAAKRIFVLDAERTFKSPQFQQQLVAVLSSLWPEVGDYHQGL 145 DC D+ RI LDAERTF + + L+ VL S++P DYHQG+ Sbjct 58 DCNDKEILRIIKLDAERTFNKEENRSLLIQVLQSIYPITNDYHQGI 103 Lambda K H 0.315 0.123 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40