bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2233_orf3 Length=263 Score E Sequences producing significant alignments: (Bits) Value 246197.MXAN_6561 61.6 3e-08 > 246197.MXAN_6561 Length=951 Score = 61.6 bits (148), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 46/176 (26%), Positives = 79/176 (44%), Gaps = 23/176 (13%) Query 67 RIMFLDVLGAGGIGVVLSAVDLSSKRRIAVKVCRLRSRSRRGPQYDQDVLKRRVQQEISL 126 R + L +LG GG+G V +A D R++A+K+ + +RS D++ + R+ +E Sbjct 84 RFIPLKLLGQGGMGAVFAAYDPDLDRKVALKLLSVEARS-----ADEEGGRARLLRE--- 135 Query 127 WKYVPPALDVQQWSQISQVVMPLDLIEPIEKIIHTDTESSIYSQEWVVFDVFPGDLLSIS 186 Q +++S + PI ++ DT+ ++ EWV Sbjct 136 ---------AQAMARVSHPN-----VIPIYEVGTWDTQV-FFTMEWVAGGTLADWRREKL 180 Query 187 EVWKGRMPVRIEVAKQVMYLHAMGLVHSDIKAPNFFVHHDGRIYLGDNGLCTPANQ 242 W+ + ++ + + HA GLVH D K N V DGR+Y+ D GL P + Sbjct 181 RSWREVLEKYLQAGRGLEAAHAAGLVHRDFKPANVLVGRDGRVYVTDFGLARPVDN 236 Lambda K H 0.322 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 82550835765 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40