bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2251_orf1 Length=409 Score E Sequences producing significant alignments: (Bits) Value 5833.PF07_0026 202 2e-50 > 5833.PF07_0026 Length=961 Score = 202 bits (514), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 100/259 (38%), Positives = 158/259 (61%), Gaps = 0/259 (0%) Query 150 REAADRLKDLGNESFRRGMYGLAAEYYSKAIEADGTVASYFTNRALCHKREKRYPEALQD 209 ++ A++ K LGN+S++ G + A +YY+KAI+ D T Y+TNRALC+K++K + A D Sbjct 702 KKEAEKYKVLGNQSYKLGYFESAIDYYTKAIQYDNTNHVYYTNRALCYKKQKLWKLANMD 761 Query 210 AEAALALEEANVKGLYIKGDALVQLGDYDAGVNLLEKAQTASSSGSGRAAHEIRHSLLNA 269 A AL LEE +VK +I G L+ L + G+ L KA+T SS EI ++ A Sbjct 762 ARQALNLEEESVKAHFILGLTLLHLNSLEEGLKKLTKAKTLSSYLKDSNESEINRYIMQA 821 Query 270 KKLRHARHCRQRRADRKDLEAFLKECIELAAEHRQLSRGEVDSRLAQLEHLVAEATEADT 329 KKL + R + ++ +L++F + I L + ++ E R+ Q E + E ++ Sbjct 822 KKLIYLRDEQNKQLSYTELQSFFIDKINLLNQIGYITNEEKSLRIQQTEGIFKELLDSFQ 881 Query 330 PFEIPDFLTCRISMGLMDEPVVTPSGITYEHKLLLEHLHRNGPTEPLTREPCDAKRLVPN 389 ++PD+L C+ISM LM+EPV+TPSG+TY+ L EH+ NG +P++RE + ++PN Sbjct 882 KKQVPDYLCCKISMCLMNEPVITPSGMTYDKIFLYEHVKHNGSFDPVSREQFSIREVIPN 941 Query 390 YAIREATTWFLERYPWAYD 408 YAI+EAT FL+ PWA++ Sbjct 942 YAIKEATEHFLKANPWAFE 960 Lambda K H 0.311 0.127 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 164060161270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40