bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2299_orf2 Length=221 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0635c 94.4 3e-18 > 5833.PFI0635c Length=147 Score = 94.4 bits (233), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 52/131 (39%), Positives = 72/131 (54%), Gaps = 1/131 (0%) Query 13 MAKGLRCKTKRAFRAVKRQHVSPTVEAARMQALQQRLHMVQQGQDPMQLNKRPLNKFLHP 72 M KGLR K KR FR +KR HV VE ++ L R+ + +D Q RP NKFLHP Sbjct 1 MGKGLRSKVKRRFRTIKRIHVREHVEKPNLKKLNDRIKSMLNNKDIYQDLVRPPNKFLHP 60 Query 73 DAPDAVFPQKTPGPRPLDFRSESLPLAGLVGWGQRKKFTEEEKVELVSIFNCLPGRTEGS 132 D +AV PQ + +DFRSE+LPL+G G R+K+ E++ L + F E + Sbjct 61 DDENAVIPQHKI-TKKIDFRSEALPLSGFATVGNRRKYNLTEQMSLKNEFGGNANFFENT 119 Query 133 QVQKARETLRR 143 +V K E + + Sbjct 120 EVSKMIEEMHK 130 Lambda K H 0.317 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 59781045954 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40