bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2300_orf1 Length=196 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_6G08430 62.0 1e-08 > 5085.AFUA_6G08430 Length=224 Score = 62.0 bits (149), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 6/90 (6%) Query 101 TNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRHQLSQEQHRATTGAAIPG 160 T+ TG R IP+S RPDG+ RR IKVRPGY P E+++ YK R + ++R + G +PG Sbjct 10 TDALTGERYIPSSVRPDGSKRREIKVRPGYRPPEDVELYKNRAAAAW-RNRGSGG--VPG 66 Query 161 LTA-AACCEQLTNLSISNKEANASRDPAKR 189 + E N + SNK NA R AK+ Sbjct 67 AEGLSEASENKANTAASNK--NAKRREAKK 94 Lambda K H 0.311 0.123 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46123291875 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40