bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2327_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 348780.NP3552A 78.2 7e-14 > 348780.NP3552A Length=257 Score = 78.2 bits (191), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 46/98 (46%), Positives = 58/98 (59%), Gaps = 3/98 (3%) Query 21 MGNSPALLALRSDKYIPHSVVLITGATKGIGKELALRYARRGCSLVLAARGEKALQAAKA 80 MG+SP + S P V LITGA+ GIG A +A G ++VLAAR E +L A Sbjct 1 MGSSPNVGVTESSDTNP--VALITGASSGIGAATARHFAHSGTNVVLAARNETSLTAVAD 58 Query 81 ECLAAGAGGCLAVPTDVTKEAACAHLISEAVREFGRLD 118 +C AAG+ LAVPTDVT+ A A L+ + FGRLD Sbjct 59 DCEAAGS-NALAVPTDVTEYDAVAALVDATIDRFGRLD 95 Lambda K H 0.320 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40