bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2349_orf1 Length=599 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_2300 106 2e-21 > 5807.cgd8_2300 Length=1673 Score = 106 bits (264), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 52/135 (38%), Positives = 77/135 (57%), Gaps = 0/135 (0%) Query 141 CGEGQEGDSAGAAAACLADPQRWRALLNGAISQALTEAIQESRFSAFVELPSPTVYKDYY 200 G G E + + + R LN AI QA A++ + A++ LPS T++ DYY Sbjct 1458 LGTGNELEDLNEEQITPEEIEYRRESLNDAILQACDMAMKIPEYEAYISLPSQTIFPDYY 1517 Query 201 ERVAKPVCLLQIRRFADKHEFTSLNKVEKYLTRLTENARAYNGQESPIFLRALECMGFVL 260 + ++KPVCL IR+FA K EFTSL+K+EKYL RL NA+ YNG ++ AL ++ Sbjct 1518 QIISKPVCLQHIRQFAKKREFTSLHKLEKYLERLASNAKTYNGVSHFLYYSALHLTNTIM 1577 Query 261 IRSRVNACVAFHSMQ 275 + R VAF++ + Sbjct 1578 MEVRKRVAVAFYTYK 1592 Lambda K H 0.311 0.126 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 270953006205 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40