bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2387_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_1080 74.7 8e-13 > 5807.cgd8_1080 Length=662 Score = 74.7 bits (182), Expect = 8e-13, Method: Composition-based stats. Identities = 56/159 (35%), Positives = 82/159 (51%), Gaps = 31/159 (19%) Query 4 YEQRVFHFGMPDALFQLFPLPSPYLLQKIADDLVSLCVTMG--QKPAIRYH---RNQLP- 57 Y+ R F+ + D LF S L Q+I + +LC T+G KP IRY R ++ Sbjct 143 YDSRTFYIDI-DGLFTTSLDLSEKLQQQIMSGINTLCKTLGVNSKPVIRYQASGRVEVST 201 Query 58 ----WCEQLATLVHKGLKSEKIPPSDERDTILLILDRSVDLAPLFVHEYTYQALAYDVLE 113 E+L L + G +S +E TILL LDRS D APL++H+Y YQALAYD+L Sbjct 202 ECKNLAEKLNYLQNGGAES------NEECTILL-LDRSFDTAPLYIHDYHYQALAYDLLN 254 Query 114 LPVCC-------------LNSSKASHSDTPEVLEDVFEY 139 +PV L+++ + D + ++DV+EY Sbjct 255 IPVSISNPDHYNILSSTRLDNTNLKNKDENQKMDDVYEY 293 Lambda K H 0.322 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40