bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2414_orf2 Length=267 Score E Sequences producing significant alignments: (Bits) Value 7227.CG4839-PB 66.2 1e-09 > 7227.CG4839-PB Length=1003 Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 15/136 (11%) Query 1 RQTAVIYPHAVVPGYAAPEASVSVDSDGDSVAQYDFGCGYGTDCWSLGCLVHELLVGEPP 60 RQ A P Y APE + D G D W+LG LV+ELLVG+ P Sbjct 842 RQNEKTNTFAGTPEYVAPEIIL------------DRGHDRAVDYWALGILVYELLVGKTP 889 Query 61 FKSVSSTAV-AQALCGYHELSLTQQMPAAAVDFIKSLLRPKEEERLG--SRDIKELLKHH 117 F+ V+ + Q L G + + ++P +A ++ L + ERLG + I ++ +H Sbjct 890 FRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHS 949 Query 118 FLEGVDCMALHFQPLP 133 + E +D L + LP Sbjct 950 WFESLDWQRLKLKQLP 965 Lambda K H 0.318 0.133 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 84961079145 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40