bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2422_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0231382 68.9 5e-11 > 44689.DDB_0231382 Length=79 Score = 68.9 bits (167), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 36/71 (50%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Query 33 VPAPPSATDKTLYLVLGILNCFIFGLGMIIIGATSGDNA-NLLIGVLQLLLPFVGWVWGI 91 +P+ + +K + ++ GIL+ F FG+G II+GA N +LIGVLQL LPFVGW W I Sbjct 8 MPSAIPSLEKNVMIICGILDFFFFGVGTIILGALDDCNVWCVLIGVLQLCLPFVGWFWSI 67 Query 92 VWGVLIVMRAL 102 +WGVLI+++AL Sbjct 68 IWGVLILLKAL 78 Lambda K H 0.329 0.144 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40