bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2461_orf2 Length=284 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb927.5.3950 93.2 9e-18 > 5691.Tb927.5.3950 Length=318 Score = 93.2 bits (230), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 59/170 (34%), Positives = 83/170 (48%), Gaps = 28/170 (16%) Query 115 GVLSNAECQRIIESAESQGFEYWAEETDTAASMSTSVESANSESGADDRSERSENVSSSS 174 G LSN EC ++I + E G+ +W ++ A E A A+ R+ Sbjct 48 GFLSNDECDQLIAACEKVGYTFWRQKDPNAEG-----EEAGCCGEAEARA---------- 92 Query 175 RLSKKANHNYRSAHTLEVEHPDLAEVIWQRVGNLV-VKEVHFSPD---DAERFERDLEGT 230 +R T+E P L++V+ R+ +V + FSP E F RDLEGT Sbjct 93 ---------FRVVDTIEANFPTLSQVLSSRIEKVVKLDPKTFSPSMEGAEELFARDLEGT 143 Query 231 WEACGVNSTLLFARYASGENFGPHTDGCTIKDFNCRSLWPMVIYLNTPES 280 W + LLFARY +G +F PH DG TI D N RSL+ ++IYLN E+ Sbjct 144 WVPQQLAQNLLFARYGAGGHFSPHIDGSTIVDINTRSLYTLLIYLNDCEA 193 Lambda K H 0.313 0.127 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 94212178333 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40