bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2523_orf2 Length=132 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_250 87.8 9e-17 > 5807.cgd2_250 Length=130 Score = 87.8 bits (216), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 52/114 (45%), Positives = 75/114 (65%), Gaps = 1/114 (0%) Query 1 SSNNMKTSNALIQQLLRAEEEAEQIVHKARENRVKMLKDARASAEEELRAFRLKEEERFK 60 + N S+ALIQ+L+ AE +AE+IV +A+ENR+ LK+A+ SAEEEL+AFR KEE +F+ Sbjct 4 TGKNGTGSSALIQKLMDAEVDAEEIVRRAKENRILKLKEAQISAEEELKAFREKEEAQFE 63 Query 61 VEVEQRLGQDDSLTNELADRTKAEIEIIKKDYVANKDGVLDFISRKVLDVDIVI 114 E + +DS+ L T+ IEI+K D+ N V D I +KVL VD+ + Sbjct 64 SEF-KNFSVEDSVDQTLEKSTEEAIEIVKNDFKNNGGAVADLILKKVLSVDLSL 116 Lambda K H 0.313 0.130 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40