bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2536_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0233 159 2e-38 > 5833.PF13_0233 Length=818 Score = 159 bits (402), Expect = 2e-38, Method: Composition-based stats. Identities = 64/111 (57%), Positives = 86/111 (77%), Gaps = 0/111 (0%) Query 16 EEVKTAAGLKKKVSDVHVFDQSGAVFKGFQIWTDLAPAVREQPNLMFAKCAVQSGSSKEV 75 EE+KTA+ + ++VS+V FD+SG+VFKG+QIWTD++P + PN+MF KC VQ GS KE Sbjct 6 EEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQGSKKEK 65 Query 76 LVVQQVEPAGGGETFEVPQAHAWNVNSAIDPMTYGDIGMLPHTNIPCVLDF 126 L V Q++P G G +++ HAWN NS +DPM++GDIG+L HTNIPCVLDF Sbjct 66 LTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDF 116 Lambda K H 0.318 0.131 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40