bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2542_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0065 96.3 2e-19 > 5833.PF14_0065 Length=284 Score = 96.3 bits (238), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 45/108 (41%), Positives = 70/108 (64%), Gaps = 8/108 (7%) Query 10 MWFTTRQEGLDDPRPAMRGPCVDLPGAIFCGSINGNSFLLRGGFLLQLFSLSGLFISYWA 69 MWFTTRQ+GLDD RGPC + G F G+ LR GF L+ +L+ LF+SYW+ Sbjct 1 MWFTTRQDGLDDNCHTNRGPCFQISG--FFGTT------LRIGFFLEFIALTFLFMSYWS 52 Query 70 SGGSGLFGYELQGMNEAARSSEGFHAALAFFSGLYMLGATYLVCFQAI 117 +GG GLF Y+L+ +N+ R + F ++ ++G+Y++GA +++ FQ + Sbjct 53 NGGKGLFSYDLKNINDEYRLDQTFRNSITLWTGVYLIGAIFIMSFQVL 100 Lambda K H 0.327 0.144 0.466 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40