bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2626_orf3 Length=191 Score E Sequences producing significant alignments: (Bits) Value 5478.CAGL0G07172g 70.5 3e-11 > 5478.CAGL0G07172g Length=866 Score = 70.5 bits (171), Expect = 3e-11, Method: Composition-based stats. Identities = 44/101 (43%), Positives = 59/101 (58%), Gaps = 7/101 (6%) Query 44 SHEPHATEIRQEFPIYDRELLALVMALDKWSYLLRVSKVTASTDHQALTHLQRLQPSKPL 103 SH+ H+ E R + I D+EL A+V AL KW++ ++ S V TDH+ +L RL P Sbjct 207 SHKLHSYETR--WHIRDKELYAIVFALKKWTHYVQGSHVIIYTDHKTNVNLNRLALLSP- 263 Query 104 RGRTARWLDFLAEFPDLHITYVQGARNQVADALSRRPGLPD 144 R ARW + LA + D I Y+ G RN AD LSR PG P+ Sbjct 264 --RLARWAEVLANY-DFEIKYIPGPRNH-ADILSRPPGEPE 300 Lambda K H 0.319 0.130 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40