bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2661_orf1 Length=188 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G58740.1 150 2e-35 > 3702.AT5G58740.1 Length=158 Score = 150 bits (379), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 67/141 (47%), Positives = 93/141 (65%), Gaps = 0/141 (0%) Query 45 HDGRLLYEWEQDLTDVHIYLKPPPKTEAKEISVRISPNKLAVGLIGKPPLFDEELSSTVE 104 H+G+ ++EW+Q L +V++Y+ PP K +I + VG+ G PP + +LS+ V+ Sbjct 15 HNGQKVFEWDQTLEEVNMYITLPPNVHPKSFHCKIQSKHIEVGIKGNPPYLNHDLSAPVK 74 Query 105 TAASFWMMEDGELHIQLGKMRKGEVWKSALKGHATLNPLAAEEVQKKLMLERFGEEHPGF 164 T SFW +ED +HI L K KG+ W S + G L+P A + QK+LML+RF EE+PGF Sbjct 75 TDCSFWTLEDDIMHITLQKREKGQTWASPILGQGQLDPYATDLEQKRLMLQRFQEENPGF 134 Query 165 DFSGATFSGSAPDPRSFMGGI 185 DFS A FSG+ PDPRSFMGGI Sbjct 135 DFSQAQFSGNCPDPRSFMGGI 155 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41203474075 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40