bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2723_orf1 Length=219 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0649 72.4 1e-11 > 5833.PF14_0649 Length=2558 Score = 72.4 bits (176), Expect = 1e-11, Method: Composition-based stats. Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 5/129 (3%) Query 14 RYAFTAVINVPEWMFPSLNKQEFLHENNKPYLKFKARCMKLMQDYLSRCFYPQALNSWLE 73 +YA T ++NVP W+ PS++KQEF+HENN +L FK + + L++ YL C L W E Sbjct 2318 KYALTVIVNVPYWLKPSISKQEFIHENNYAFLVFKKKLIGLIKHYLFICQDNVKLRKWRE 2377 Query 74 QRAKRLSDYQDAQRLTRPKRRLNEDLTDEEQPRRSPTPPLAHSSSGAPIWTGQRGSNAGS 133 R +L Y D + K + NE D+E + ++ S +G NA S Sbjct 2378 SRDLKLKRYLDKSSFSFDKSK-NESDNDDENDYKITNQEKENAQSEKE----GKGKNAQS 2432 Query 134 ANNSAEAKQ 142 NN + + Sbjct 2433 PNNDNDQNE 2441 Lambda K H 0.309 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 58561024608 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40