bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2728_orf1 Length=224 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G42810.2 82.8 8e-15 > 3702.AT2G42810.2 Length=538 Score = 82.8 bits (203), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 9/95 (9%) Query 129 LERAEALKNEGNVLFKQHQYAEAVAKYSAAIDLVDEAPVDPRETQLHVFLCNRAFAHLRM 188 + RAE K++ N FK H+Y+ A+ Y+ AI+L + V+ NRAFAH ++ Sbjct 10 VSRAEEFKSQANEAFKGHKYSSAIDLYTKAIEL---------NSNNAVYWANRAFAHTKL 60 Query 189 ENFGSAIIDAERALKLNPKFSKGYYRRGTGYFCLG 223 E +GSAI DA +A++++ ++SKGYYRRG Y +G Sbjct 61 EEYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMG 95 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 61611077973 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40