bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2734_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0205113 72.8 2e-12 > 44689.DDBDRAFT_0205113 Length=314 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 47/144 (32%), Positives = 75/144 (52%), Gaps = 16/144 (11%) Query 5 NRMPG-PEVFLNIYKIHGSPDW--CSPCGLYHTSVQIGELEYSFGEDSGVMCSEHNPRID 61 NR P +V+LNIY +H ++ C GL+H++V+I E F S H Sbjct 8 NRGPNITKVYLNIYDLHPINNFGHCLGVGLFHSAVEINGNEIGF--------SGHEWSFS 59 Query 62 GIHSFLDGT-----YEYSLHMGACNLSVPELHKVISSLQKSFPGSSYDLIRNNCNHFSDA 116 G++ T + SL+MG LS ++ +I ++ + FPG SY ++ NCN FS+ Sbjct 60 GVYEIKPKTATGVVFRESLYMGDVTLSERQIQSLIDNIAEEFPGKSYHPLKKNCNTFSNE 119 Query 117 LLKSIVGRGIPPHINRASRYGQWL 140 L+K ++ R IP +INR + G + Sbjct 120 LIKRLLNREIPNYINRLAFIGTFF 143 Lambda K H 0.321 0.141 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40