bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2735_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000078145 89.0 4e-17 > 7955.ENSDARP00000078145 Length=771 Score = 89.0 bits (219), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 56/145 (38%), Positives = 75/145 (51%), Gaps = 32/145 (22%) Query 6 GPYSPLLYPFDEFRMETNILHPDEELEQRMNERRIAKHRERERRLIQLGIDKDKNEKEEE 65 G YSP L E ++T+I+ +E+L++ + RR Q+ + D +E E+ Sbjct 570 GRYSPTLLQNSELPLDTHIIAEEEDLQRLLLARR------------QMQVTGDASESAED 617 Query 66 ENDDEILDPAAKIVTYEDFVRKEQKNASPDEEVMADSSEMKLK-QHYGWEEKYRPRKPRF 124 FVR+ ++ DE S EM L + Y W +KYRPRKPRF Sbjct 618 L-----------------FVRRAKEGMGGDEAQF--SVEMPLTGKMYLWADKYRPRKPRF 658 Query 125 FNRVRTCYFWNKYNQTHYDHDNPPP 149 FNRV T + WNKYNQTHYD DNPPP Sbjct 659 FNRVHTGFEWNKYNQTHYDFDNPPP 683 Lambda K H 0.315 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40