bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2760_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0120 229 4e-59 > 5833.PF10_0120 Length=192 Score = 229 bits (583), Expect = 4e-59, Method: Compositional matrix adjust. Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 0/164 (0%) Query 3 VAFTPAAPQPSAVRSFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKE 62 + + P + S +R +L+ P +F+F R P +RW A K+LRE GLMYDD+YSDK+ Sbjct 22 LGYEPPKKKRSILRELYHKLIFPYYFKFIRAPYERWQFCATTKFLREHGLMYDDMYSDKD 81 Query 63 PVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKFQL 122 PVIERA+ LLP+D+ T RYRR++R TH+N++RL+L P+EQNYDP+IPYLAPY+EEAKFQL Sbjct 82 PVIERAISLLPKDIQTRRYRRMLRGTHINYLRLFLHPSEQNYDPYIPYLAPYIEEAKFQL 141 Query 123 QEEEELLGYHMWERRLYSGGCTGLGDFEPGMHFLVSFPNMYGGG 166 QEEEELLGYH ++RRLYSGG TG GD EPG+HFLVS PN+YG Sbjct 142 QEEEELLGYHPYDRRLYSGGTTGFGDLEPGLHFLVSIPNLYGAA 185 Lambda K H 0.322 0.141 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40