bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2808_orf3 Length=167 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_1690 111 8e-24 > 5807.cgd2_1690 Length=100 Score = 111 bits (277), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 51/107 (47%), Positives = 72/107 (67%), Gaps = 9/107 (8%) Query 42 SIVQPSRFLDAAVLALFAMLVSALSLYMFGELWNVAQDPKFSSWRVGFILQKLFPFKRTF 101 S+V SRFLD+A++ +F + +S L+LY+FGE W + Q P S W +G I+ LFPFKRTF Sbjct 3 SVVSYSRFLDSAIMGIFTICLSGLTLYLFGEFWGLCQSPPLSKWSIGKIMSTLFPFKRTF 62 Query 102 DVNLTHILLFTVAVLLLSLRPELPPGYEESSSSSSSSRRARTQQRAE 148 DVNLTHILLF++ + LLSLR S ++SS+ + Q+R + Sbjct 63 DVNLTHILLFSIIICLLSLR---------SDQGTNSSKCGQKQKRND 100 Lambda K H 0.320 0.131 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30498925597 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40