bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2850_orf3 Length=225 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0945w 246 3e-64 > 5833.PFI0945w Length=207 Score = 246 bits (629), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 113/206 (54%), Positives = 145/206 (70%), Gaps = 7/206 (3%) Query 13 QYCSPYNAEKRRFNEEQILAAGGKEGAAAPAMPMPPAYRDMDLILFPEGSLKDSNGNVVS 72 + SPY AEKRR +E + + MP Y DMDLILFPEGSLK+ N VV+ Sbjct 5 NFNSPYQAEKRRTSE-------NADNCKLETLNMPINYSDMDLILFPEGSLKNINNTVVN 57 Query 73 QQHLIGKSVGLYFADGSSPKCSSFLPFLLQFYRTVNEGGSHQKIEVVFVSADKDERAFQD 132 ++HL GKSV ++F++GS PKC +FLPFL Q+Y+T+NEGGS QKIEV+FVS D D ++F+D Sbjct 58 EKHLFGKSVAIFFSNGSDPKCRAFLPFLQQYYKTINEGGSSQKIEVIFVSIDPDRKSFED 117 Query 133 HVKHMPWLVIDFNDPLRTILLRHFRVEKEASVPTQGQGPRAGVPSLVVVGSDGRDAQFLQ 192 H KHMPWL +D DPL IL +HFRV VP G GPR+ VP L+VVGSDGR++Q L Sbjct 118 HKKHMPWLYVDVADPLTDILKKHFRVTNSHEVPFYGSGPRSDVPCLIVVGSDGRESQLLH 177 Query 193 VSGGRDEGERALLRWDWRNTKFGADR 218 + GRDEGE+ LLRWD+RN + ++ Sbjct 178 ICSGRDEGEKGLLRWDFRNNIYTPNK 203 Lambda K H 0.321 0.139 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 61360267097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40