bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2872_orf1 Length=206 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1335c 131 1e-29 > 5833.PFF1335c Length=189 Score = 131 bits (329), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 69/150 (46%), Positives = 97/150 (64%), Gaps = 1/150 (0%) Query 57 KTALVVLANGAEDVEFVAAVDVLRRAGMKVLVASVGDSLFVKTSHGLKIEGDILLKEVSE 116 KTALV +A+G+EDVE++ VDVLRRAG+ V ASV S V + D + +V Sbjct 5 KTALVAVASGSEDVEYITVVDVLRRAGVHVTTASVEKSEQVCLQSKNVVLADTTISKV-R 63 Query 117 QNNYDVIVIPGGLKGAENCRDSSHLAALLRAQHSSSKWIAAICASPALVLQQQGFLENVR 176 N YDV+VIPGG+KG+ + S +L+ Q ++++ AAICA+P VL + +++V Sbjct 64 NNIYDVLVIPGGMKGSNTISECSEFIDMLKEQKANNRLYAAICAAPETVLDRHSLIDDVE 123 Query 177 AVAYPSFQQQLPLKGEGRVCVDKHFITSVG 206 AVAYPSF++ G+GRVCV K+ ITSVG Sbjct 124 AVAYPSFERNFKHIGKGRVCVSKNCITSVG 153 Lambda K H 0.316 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 51449491716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40