bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2892_orf1 Length=193 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0174 122 8e-27 > 5833.PF11_0174 Length=700 Score = 122 bits (305), Expect = 8e-27, Method: Composition-based stats. Identities = 70/178 (39%), Positives = 100/178 (56%), Gaps = 19/178 (10%) Query 29 KLSPQSVLSCSFYNQGCHGGLPYLVGKHATEIGILDEQCMPYTAMDLSSCPVLNRNKNEK 88 +LS Q+VLSCSFY+QGC+GG PYLV K A GI PY+A + +CP N +K+ Sbjct 430 QLSIQTVLSCSFYDQGCNGGFPYLVSKLAKLQGIPLNVYFPYSATE-ETCP-YNISKHPN 487 Query 89 DFLKSEKDFLKGEINGSGEDSSSNAAF-----------LFSGEATGTCHQG---ENRWFA 134 D S K L+ EIN +++ + + +++ A+ G ENRW+A Sbjct 488 DMNGSAK--LR-EINAIFNSNNNMSTYNNINNDHHQLGVYANTASSQEQHGISEENRWYA 544 Query 135 KGYGYVGGCYECLSCSAEQKIMKEIMTNGPVAAALDAPPSLFAYSSGVYTTRGAPHAR 192 K + YVGGCY C C+ E+ +M EI NGP+ ++ +A P + Y+ GVY PHAR Sbjct 545 KDFNYVGGCYGCNQCNGEKIMMNEIYRNGPIVSSFEASPDFYDYADGVYFVEDFPHAR 602 Lambda K H 0.314 0.130 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44278360200 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40