bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2899_orf4 Length=280 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_2640 62.0 2e-08 > 5807.cgd7_2640 Length=319 Score = 62.0 bits (149), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 29/213 (13%) Query 3 AQLEEGAASLPLYSKAIDMLESAARVGPRSSSSSSKSSSSSGAAAEFSQKEARAHLVRAY 62 AQ+ +G SL ++ I++L+ + ++ + + S + L AY Sbjct 81 AQILDGEESLSYWNNGIEVLQESIKIVEKKGNDKSCIERLDLM---------KNQLCSAY 131 Query 63 AAVAELYLTDLCDEAEAEAAAANAINKALLLDPDSPDALLCEAQFKKVKEDREGAMAAAG 122 A++EL++TDLC EAE+ + KA +D + + L C+ + K +D E Sbjct 132 CAISELFMTDLCYSDEAESQVKENLAKASEIDDEHFETLCCKLAYFKTIDDFEECKKYVF 191 Query 123 RLHAVLKRLQEKAAAGLLLWQREHGAAAAAAADGQEEENASI-----EIRVNAGRLFIDL 177 ++ +L ++ + E N I +R+N R IDL Sbjct 192 KIKYIL--------------ANKYNLSVEFNDFADELRNKDIILPEYSVRLNLSRTLIDL 237 Query 178 EMVEEALEVLSSCLEENEDDPEVW-LVYCCGLL 209 E A VLS+ L+E+E+D ++W L+ C L+ Sbjct 238 NETELAELVLSTLLKEDEEDWQIWYLLSWCSLV 270 Lambda K H 0.311 0.125 0.341 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 92794370130 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40