bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2903_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC119.02 245 6e-64 > 4896.SPBC119.02 Length=147 Score = 245 bits (625), Expect = 6e-64, Method: Compositional matrix adjust. Identities = 114/130 (87%), Positives = 124/130 (95%), Gaps = 0/130 (0%) Query 66 MALKRINKELNDLSKDPPTNCSAGPVGDDLFHWQATIMGPEDSPYSGGVFFLNIHFPSDY 125 MALKRIN+EL DL KDPP++CSAGPVGDDLFHWQATIMGP DSPY+GGVFFL+IHFP+DY Sbjct 1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDY 60 Query 126 PFKPPKVNFTTKIYHPNINGQGAICLDILKDQWSPALTISKVLLSISSLLTDPNPDDPLV 185 PFKPPKVNFTT+IYHPNIN G+ICLDIL+DQWSPALTISKVLLSI SLLTDPNPDDPLV Sbjct 61 PFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query 186 PEIAHIYKTD 195 PEIAH+YKTD Sbjct 121 PEIAHVYKTD 130 Lambda K H 0.321 0.141 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40