bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2916_orf3 Length=212 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0107 99.4 7e-20 > 5833.PF10_0107 Length=119 Score = 99.4 bits (246), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 50/131 (38%), Positives = 78/131 (59%), Gaps = 25/131 (19%) Query 77 KKQQQQEQPAVAVNQPEVEDLRKRLQGGMAIIVLLQDGTKLACTLHLNPSDKSLSISCED 136 KK ++ + E+ + +KRL+ + I+VLLQ Sbjct 14 KKYLNDDEILETFSNSEINEFKKRLKNNIQIVVLLQ------------------------ 49 Query 137 KVRVIPLSDVKSLLHTRDQLKRVETKANLVDDENCVALHLIESGNCIPIRFEAVKDKHIF 196 VR+I SD++SLL+ +QLKRVET+ANL++D C+ALHL +SGNCIPI+F +VK+K++F Sbjct 50 -VRMINFSDIRSLLYGEEQLKRVETQANLINDNCCLALHLDDSGNCIPIKFGSVKEKNLF 108 Query 197 VEMMKQLKEEA 207 + +MK K+ + Sbjct 109 IFIMKDYKKNS 119 Lambda K H 0.309 0.123 0.332 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54290949897 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40