bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2920_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0900w 98.6 4e-20 > 5833.PFE0900w Length=268 Score = 98.6 bits (244), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 4/88 (4%) Query 9 MARHSKNATSAPFYSYHERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQ 68 MARHSKN T+ P ++YHERKK++ GTL+ RL + R+FE CW+CL A NP+++P Sbjct 1 MARHSKNNTANPIFTYHERKKVK----GTLRERLGKDSMRKFEQCWICLRTAENPVSSPY 56 Query 69 GLIFCKECLFLNFESQKKKIQKETKAWE 96 G IFCK C+ NF +QKK ++ K +E Sbjct 57 GHIFCKICIINNFLNQKKIYARKKKEYE 84 Lambda K H 0.316 0.124 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40