bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2937_orf1 Length=200 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0720w 79.7 5e-14 > 5833.PFF0720w Length=1096 Score = 79.7 bits (195), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 49/197 (24%), Positives = 82/197 (41%), Gaps = 58/197 (29%) Query 4 SAILSASVNEKIRAILFSSVKKVWFYSLFTWFIFESTGMPVVYVPTAASSLLALLPILPP 63 S+I ++ ++AI+ ++K+++FY+L+ W IF P++YVPT LL I Sbjct 756 SSIFFYNITNNLKAIIICTLKRIYFYTLYIWLIFSFFQFPIIYVPT-------LLCI--- 805 Query 64 EVISLLPAVALWLHSDAAAAAAAAAGGGPPAEAAAAAAAAAAAAAPGGAGTPAAAAAAAA 123 ++SL+P ++ P Sbjct 806 -ILSLIPVIS-----------------------------------------PEILILVII 823 Query 124 AAAAGGWGHWFAAPHRLAALAVLAANALVWWNVTTCIYREIPDASPWLVGLSAALGLSTL 183 ++ +L + N ++ +T IY EIP WLV LS L +ST Sbjct 824 LHLWI------IKKQKIISLILFIVNFFIYCYFSTSIYNEIPHTHAWLVSLSLFLSISTF 877 Query 184 GLKGIILGPVLATVPLI 200 G KG+ILGP++ ++PLI Sbjct 878 GSKGLILGPLIGSIPLI 894 Lambda K H 0.319 0.129 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47774528022 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40