bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3047_orf2 Length=219 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0093 154 2e-36 > 5833.PF11_0093 Length=568 Score = 154 bits (388), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 68/190 (35%), Positives = 116/190 (61%), Gaps = 0/190 (0%) Query 25 ADWTDPAPSADPTSFESALNRLRQRRKRRPKPLDSDLQLFCNQMLQKMSEASQQDERSLE 84 + ++ + + F+ L + +RKR K + D +C +L +M +QD +S++ Sbjct 284 GNHSNISEKKKKSHFDEILENFKSKRKRVHKISEDDGLEYCENILNQMILMHEQDLKSMK 343 Query 85 AGEPATAKLQMLDTVCTELVKPKWRHWFVSEGCCQVIAGWLAPFKDDSLPNFSLRRRLLE 144 +PATAKLQ++D VC L KPKW+ +F+ V+A WL P ++LPNF++R LL+ Sbjct 344 EKKPATAKLQIIDNVCKILTKPKWKPFFMKLNIYHVLALWLMPTSKNTLPNFTIRTNLLK 403 Query 145 VLGQMPITAQDLANNDLGKVLVLLWQHDDETESNRQLIRGLIQKWMRPVLGLGSSHRQLI 204 V+ Q+PIT + L + LGK+L L H ETE N++LI+ ++Q WM P++G+ ++++Q + Sbjct 404 VIQQLPITIKSLRGSQLGKILTYLHSHKHETEENKKLIKNIMQNWMGPIIGINTNYKQYL 463 Query 205 SERERAFEAN 214 ER++ N Sbjct 464 KERQKRISEN 473 Lambda K H 0.321 0.134 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 58561024608 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40