bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3054_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP000983-PA 71.2 8e-12 > 7165.AGAP000983-PA Length=1008 Score = 71.2 bits (173), Expect = 8e-12, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 5/107 (4%) Query 17 RCLVIDAGQLCDLCGAAVVCSKFFAFRCGHCMHAACVQALLIPAMSTEELGRFDRSVAAL 76 R + + A + C +CG ++ FF F CGH HA C++ ++P +S E R +L Sbjct 891 RSVTVSAQEQCTVCGIYLMLKPFFVFHCGHKFHADCLERQVLPYLSPEMSDRLTMLKQSL 950 Query 77 AAAIKEDSP-----EVEALEDALDGLLAQECLLCGSLMIRSLQVPLL 118 A A +P E L+ ++ +++ ECL CG+LMI +L P + Sbjct 951 ATAQHAAAPVAPISHKEKLKSEIEAIISSECLYCGNLMINALDKPFV 997 Lambda K H 0.324 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40