bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3062_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000013210 127 7e-29 > 8090.ENSORLP00000013210 Length=826 Score = 127 bits (320), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 4/119 (3%) Query 2 NKYRSIAAAAA----ADAIPWSVLEVFELSEEQTTSSGRIFLKVLLQEISEGLGIKTLNE 57 NK R++A A D++PWSVLE ++SEE TTSS RIF+K+L QE+ +G+ LN+ Sbjct 602 NKLRNVARLFAHLLYTDSVPWSVLECIKMSEETTTSSSRIFVKILFQELCAYMGLPKLNQ 661 Query 58 RLRHPDLKPYVKGLFPDDHPRNVRFCINFFTAIGLGGLTDHQRQLLAEMQQQAHLQQQQ 116 RL+ L+P+ +GLFP D+PRN RF INFFT+IGLGGLTD R+ L + Q Q+ Sbjct 662 RLKDTTLQPFFEGLFPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNAPKMIMTQNQE 720 Lambda K H 0.310 0.122 0.325 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40