bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3081_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 28985.KLLA0F24134g 85.1 5e-16 > 28985.KLLA0F24134g Length=1000 Score = 85.1 bits (209), Expect = 5e-16, Method: Composition-based stats. Identities = 50/126 (39%), Positives = 68/126 (53%), Gaps = 20/126 (15%) Query 6 LVEYSGEVYVHPKHKRYPPPQLAELREARYDWQH-GNCYCFAVEENLCTRYVDATDTGNL 64 ++EY GE P +AE+RE RY G+ Y F ++EN +DAT G + Sbjct 884 IIEYVGESIRQP---------VAEMREKRYIKSGIGSSYLFRIDENTV---IDATKRGGI 931 Query 65 ARYINHCCEPNAESVLL---GDSIVGIAALRDIPPGEEVFYDYHFSDSSKEA----CLCQ 117 AR+INHCCEP+ + ++ G + I ALRDI EE+ YDY F + E CLC Sbjct 932 ARFINHCCEPSCTAKIIKVDGRKRIVIYALRDIGTNEELTYDYKFERETDEGERLPCLCG 991 Query 118 APTCTG 123 AP+C G Sbjct 992 APSCKG 997 Lambda K H 0.320 0.138 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22670743557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40