bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3111_orf3 Length=268 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2225w 156 6e-37 > 5833.PFL2225w Length=204 Score = 156 bits (395), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 85/200 (42%), Positives = 126/200 (63%), Gaps = 3/200 (1%) Query 68 CPICYHKLPRPGEVLEPYDEELNYFMWIPGFEWKPKP--VPEDDAYGSEHSESEGEADED 125 C +CY LP P L PYD ELNYF W PGFE++P+P P E+SE E+ D Sbjct 5 CNVCYFNLPDPESTLGPYDNELNYFTWGPGFEYEPEPQRKPLSIEESFENSEESEESVAD 64 Query 126 MEEALKEMVENDEMQQKYNEKASGGKVSTSDAAVLARQLGLAPSYADVEKCEQENGNQLD 185 +++ L+E V+ +++ +NEK+SGGK+S +A+ AR+LGLAPS D +K ++ G+ L Sbjct 65 IQQ-LEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLT 123 Query 186 YATFQQFAAQSTHPEDNIEDLVGAFAHFDPNGTGTLTVQQMRNILMTFGEPLTKEEMSVV 245 Y + ++ + H +DN+E+L+ FAHFD N TG LT QM+NIL T+G+ LT +E Sbjct 124 YEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDA 183 Query 246 ESKFFSGNTVDYRDFCTRVL 265 + F S + +DY+ FC +L Sbjct 184 LNAFSSEDNIDYKLFCEDIL 203 Lambda K H 0.312 0.131 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 85563639990 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40