bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3212_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00035913001 89.4 3e-17 > 99883.GSTENP00035913001 Length=340 Score = 89.4 bits (220), Expect = 3e-17, Method: Composition-based stats. Identities = 42/81 (51%), Positives = 58/81 (71%), Gaps = 1/81 (1%) Query 26 YGTFATGGSDGGVSIWDGLSKKRLCRVPPLPTSVSSLAFNSSGTLLAMAVSYMFERGPQP 85 + TFATGGSDG V+IWD +KKRLC+ PTS++SLAFN+ GT+LA+A SYM E+G Sbjct 260 HNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFNNDGTMLAIASSYMQEKG-DI 318 Query 86 GQPKPQIIVRAVREEDVRPKT 106 P+ I +R V + + +PK+ Sbjct 319 SHPEDAIFIRQVTDAETKPKS 339 Lambda K H 0.322 0.138 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40