bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3229_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5141.NCU04349.1 79.7 2e-14 > 5141.NCU04349.1 Length=659 Score = 79.7 bits (195), Expect = 2e-14, Method: Composition-based stats. Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 19/154 (12%) Query 1 FVKLLEQERQQHDSSVDLLGRALQQLKRLSLDVSFDFFLERFFYFRIGRRVMVNNLLAMQ 60 F ++L + Q H ++ +L + + ++ FL+ RIG R++ +A+ Sbjct 313 FTQVLAELVQTHTDTIPILAKGFIECRKYISPSEVTRFLDEHLRARIGTRLVAEQHIALH 372 Query 61 -----------------NPK--PGWCGIVNPRCRPAEVIMARAQEVRDSCKFSYGIAPLV 101 PK P + G+++ RPA VI + V D C+ +YG+ P Sbjct 373 YSSTPHFDPEASPTLCPEPKTHPSYIGVIDTTLRPASVIDSCGDFVADICELNYGVRPEW 432 Query 102 VVAGNLETEFATIPEHLALIITEVLKNALRATVE 135 VV G + FA +P HL I+TE+LKNA RATVE Sbjct 433 VVDGEPDATFAFVPMHLEYIVTELLKNAFRATVE 466 Lambda K H 0.327 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40