bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3259_orf1 Length=163 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0310 80.1 2e-14 > 5833.PF11_0310 Length=609 Score = 80.1 bits (196), Expect = 2e-14, Method: Composition-based stats. Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 5/136 (3%) Query 28 SDEKRAKNGFLTLCRRLITGAMDHVENTPAVTTAKTQHKPCGVGRYFLLVTYVIYAFLTA 87 +++K+ +L+L + ++D + + + Q P + R LL Y + LT Sbjct 42 NEKKKGLLSYLSLKGYDMPSSLDDLLKKEEIRLSSEQKTPFNINRSVLLFVYFMLIVLTN 101 Query 88 RVYFAWPNLSNLLFRSNAYSWLCTTYLQEGNPDMREEIHGGKRYICEAQNSAVGNIFVTC 147 R++F WPNLSNLLFR + Y W C + G D ++ KRY C+ Q+ AV IF+ Sbjct 102 RLFFGWPNLSNLLFREDTYIWKCQKN-EHGEYDRFDD----KRYSCDEQDKAVQTIFIFG 156 Query 148 LAFAFSFSLAAGLLLD 163 + F+FS GL++D Sbjct 157 SSAYFAFSFFNGLIVD 172 Lambda K H 0.323 0.136 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28009217385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40