bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3288_orf1 Length=142 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0323 105 5e-22 > 5833.PF14_0323 Length=149 Score = 105 bits (261), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 53/137 (38%), Positives = 90/137 (65%), Gaps = 10/137 (7%) Query 14 LREAFALFDRDGDGELTSSEALLAIRSIGV---------VVNADEANGIPASMSWDQFES 64 +EAF+LFD+DGDG +T+ E +RS+G ++N + +G ++ + +F + Sbjct 13 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTDG-NGTIDFPEFLT 71 Query 65 WVTKKLSGSNPEADLIKSFKVFDTKGDGTLSTDELMQVMKTLGDLLTDEEVEKMVQDADP 124 + +KL ++ E +LI++F+VFD GDG +S DEL VM LG+ LT+EEV++M+++AD Sbjct 72 LMARKLKDTDTEEELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADI 131 Query 125 SKSGRIKYAEFVKVLLS 141 G+I Y EFVK++++ Sbjct 132 DGDGQINYEEFVKMMIA 148 Lambda K H 0.312 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40