bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3311_orf1 Length=196 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000026663 90.5 2e-17 > 9258.ENSOANP00000026663 Length=208 Score = 90.5 bits (223), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 77/174 (44%), Positives = 101/174 (58%), Gaps = 18/174 (10%) Query 21 VNQRAVEARERKAAAAAAKAAAAEQEAER--KRWEDNDKLVSRKLERKAESQAKAEEKMQ 78 VN +A+EA +RK + +QEAER K W D+DK + KLERKAE+Q K +EK+Q Sbjct 7 VNTKALEALQRKREQR--ELLERKQEAERLDKLWRDDDKKTNAKLERKAEAQRKHQEKLQ 64 Query 79 RKMELRKLADEEMQTL-AGNSTKKNQSPTKLTRAQILQRQLRAAAMEKEASSPSDEGSVL 137 +K ELR+LA+++ L A ST K T TRA+IL+ QL AA K S S+E V Sbjct 65 KKAELRQLAEQDQIALGATKSTTKCAQRTAPTRAEILKNQLMAAERAKADQSKSEEYIV- 123 Query 138 RLEPNINHVMRAESLQAQLEGKNIVSASNLDDALSQLALSEAGGEDRHPERRMK 191 +EPNINH+MR E + +AS LDD L AL+ D E+RMK Sbjct 124 -VEPNINHLMRQE---------HSAAASGLDDVLQ--ALNIGPKSDTKMEKRMK 165 Lambda K H 0.306 0.117 0.298 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46123291875 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40