bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3351_orf1 Length=189 Score E Sequences producing significant alignments: (Bits) Value 28985.KLLA0C08976g 80.5 3e-14 > 28985.KLLA0C08976g Length=911 Score = 80.5 bits (197), Expect = 3e-14, Method: Composition-based stats. Identities = 44/126 (34%), Positives = 61/126 (48%), Gaps = 18/126 (14%) Query 5 IRSDSQLAISIDVHGQGLVINLAKGNVLNRIRFKSNTTSKIRWQQQKQQHLVTAAAFSPD 64 I L +SIDV G+G++ N NVL+ FK V FSPD Sbjct 63 INKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEK---------------VYDLKFSPD 107 Query 65 DALFAVACGRSIQLWHSPSAATNYQLHLLTSFTLHQ---QLITCLSWSPDSLHLVSGSQD 121 LFA+ACGR +Q+W +P + Q + +H IT L+WS DS ++S S+D Sbjct 108 GKLFALACGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSKD 167 Query 122 CTVRLW 127 T R+W Sbjct 168 LTARIW 173 Lambda K H 0.322 0.128 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41818451300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40