bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3362_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1170c 140 8e-33 > 5833.PFI1170c Length=541 Score = 140 bits (354), Expect = 8e-33, Method: Composition-based stats. Identities = 71/145 (48%), Positives = 92/145 (63%), Gaps = 13/145 (8%) Query 7 FDYDYIVIGGGSGGLASGKQAAGLGARVLVLDFVKPSIRGLSWGLGGTCVNVGCIPKKLL 66 +DYDY+VIGGG GG+AS K+AA GARVL+ D+VKPS +G WG+GGTCVNVGC+PKKL+ Sbjct 40 YDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLM 99 Query 67 HFAAQTRQFGVWEAPMLGCNPYVALNPFSGFPENQLKPCDWQTLVERVQSYIKQLNFSYR 126 H+A L Y G+ + LK DW+ LV VQS+I+ LNFSY Sbjct 100 HYAGHMGSIF-----KLDSKAY-------GWKFDNLKH-DWKKLVTTVQSHIRSLNFSYM 146 Query 127 VGLQNAGCTYTRALARLVGPHTVEY 151 GL+++ Y LA+L +TV Y Sbjct 147 TGLRSSKVKYINGLAKLKDKNTVSY 171 Lambda K H 0.321 0.140 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40