bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3418_orf1 Length=294 Score E Sequences producing significant alignments: (Bits) Value 4932.YJL078C 82.4 2e-14 > 4932.YJL078C Length=881 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 57/149 (38%), Positives = 81/149 (54%), Gaps = 26/149 (17%) Query 118 DCVIEHNKKRVGKLKKPLMPMERNSDAVYQALTYAK-YVMEHGCPFKHSGADG-FGENL- 174 D + EHNK R L P+ SD + TYA+ Y ++ C + +DG +GENL Sbjct 28 DVLNEHNKFRA--LHVDTAPLTW-SDTL---ATYAQNYADQYDCSGVLTHSDGPYGENLA 81 Query 175 --YATSGPQAMCSDAVGAWYNEIKHFNGKYPGGNWTLKSGHFTQVMWSGSTELGCARTVG 232 Y +G AV AWY EI +N PG ++ +GHFTQV+W + E+GC Sbjct 82 LGYTDTG-------AVDAWYGEISKYNYSNPG--FSESTGHFTQVVWKSTAEIGCGYKY- 131 Query 233 CGSS---ILICNYKPPGNWSGEPPFSEEV 258 CG++ ++C+Y PPGN+ GE F+EEV Sbjct 132 CGTTWNNYIVCSYNPPGNYLGE--FAEEV 158 Lambda K H 0.314 0.128 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 100212954023 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40